reading fasta file into dataset

[asiddiqui]

I have an input file with a sequence in FASTA format begins with a single-line description, followed by lines of sequence data.

The description line (defline) is distinguished from the sequence data by a greater-than (">") symbol at the beginning, shorter than 80 characters in length.

The data is divided into 50 character set each, in multiples lines extending upto 1400 characters.

>gi|5524211 gb AAD44166.1 cytochrome b

LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFW

GATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVA

LAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILILLLLL

LALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGV

LALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQ

PVEYPYTIIGQMASILYFSIILAFLPIAGXIENY

My question: When I read the input file into a dataset, I created two columns, "Desc" and "Sequence". I need my dataset to have one Desc row and one Sequence row, but the sequence is getting divided up into multiple row like as follows. Looking for help either cleaning the LFCR as I create the dataset or conc the rows after the dataset is created. PLEASE HELP

Obs           Desc                                                                    Sequence

-------------------------------------------------------------------------------------------------------------------------

1          gi|5524211 gb AAD44166.1 cytochrome b          LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFW

2                                                                                GATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVA

3                                                                                LAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILILLLLL

4                                                                                LALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGV

5                                                                                LALFLSIVILGLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQ

6                                                                                PVEYPYTIIGQMASILYFSIILAFLPIAGXIENY

[PGStats]

If, as you imply, there is only one desc per file, and thus, your dataset should contain only one observation, then this should do (untested) :

data want;

length desc $80 sequence $2000;

do until (eof);

     infile "yourFastaFile.xxx"  end=eof;

     input;

     if char(_infile_,1) = '>' then desc = substr(_infile_,2,80);

     else sequence = cats(sequence, _infile_);

     end;

run;

PG

[asiddiqui]

Thnx y'all, both responses works but the sequence is reading only upto 107 characters and not beyond. My input file has 1302 sequence char.

[MikeZdeb]

hi ... can you post a portion of your data

[PGStats · Accepted solution]

Ok. Now tested with Mike's (thanks Mike) fake data (with a single DESC) :

data want;

length desc $80 sequence $2000;

do until (eof);

     infile "&sasforum.\datasets\fasta PG.txt"  end=eof lrecl=1000;

     input;

     if char(_infile_,1) = '>' then desc = substr(_infile_,2);

     else sequence = cats(sequence, _infile_);

     end;

run;

PG

[asiddiqui]

Thank you PGStats and MikeZdeb, your codes works perfectly as intended with Mike's and my dummy input file , but when I run it on my actual file (image below) it's not reading all the sequences using proc print.

I was not able to figure out why, Then It struck me maybe its something with my "proc print" output settings, so I used ODS to put in a pdf file, this time it read all my sequences but had spaces between the different sequences...hmm, Used ODS to html and boom all looks good (but cant explain why).

THANKYOU PGStats and MikeZdeb for your help and valuable time. Love this forum.

Input file

Incorrect output with spaces with ods pdf

[MikeZdeb]

hi ... if there are more than one DESC per file, I think this will work (at least it works with the attached fake data) ...

data slowa;

infile 'z:\fasta.txt' end=done;

length desc $100 sequence $1400;

do _n_=1 by 1 until (done);

   input @;

   if char(_infile_,1) eq '>' then do;

       if _n_ ne 1 then output;

       desc = substr(_infile_,2);

       call missing(sequence);

   end;

   else sequence = cats(sequence,_infile_);

   input;

end;

output;

run;