Background: HIV-1 impacts 3.2 million children, 35 million active cases,with 2013 estimates. In assay of the pathogen, it is possible to mine precursor elements of species donation via use of repeat elements of gene. This observation is possible, within HIV-1, using P-117 mole weight markers in repeat, observed precursor as potential donor in the avian species. Having demonstrated the beta model, it would be very useful to design high thru-put search regards...or active statistical data via repeat. Because the polymorphism elements as mutagenic forward are variable, this is a difficult task. An example: PPPPAI driven by the following data. Note the position value, mixed HIV complement: PPPPA The output of this assay, becomes a library of polymorphism control element via pathogen to host. Why this is valuable, is also seen in MDR mutation, in non viral species. You see, the problem of additive post polymorphism, gene residue, is a solution not easily solved with insertion forward sequence variant to search. The pathogenesis has impact to host via additive, larger residue set, post variable identity. XP_005532556 1 MSISGTLSNYYVDSIISHESEDSPSSKFPPGQFSSRQSEHLEFPSCSFQPKPAVF passerine donor sequence data , avian to HIV -1 beta model with P-117, observation. DAPPPAPAADGV I hope at least, to demonstrate the interesting problem of SNP solve. SNP, as conserved, cannot proceed in single identity, as it must be pair wise or larger set, to satisfy the underlying rules of reaction. McGary
... View more